Histone H1-like DNA-binding protein involved in the organization and segregation of kinetoplast DNA (kDNA). The mitochondrial DNA of kinetoplastid protozoa consists of about 5,000 minicircles and 20 to 30 maxicircles. These circular DNAs are held together by catenation into a highly organized compact disk structure referred to as a kinetoplast DNA (kDNA) network. Binds preferentially to a specific fragment of minicircle DNA and is able to compact kDNA networks through DNA charge neutralization and condensation. KAP22_CRIFA Histone H1-like protein p18-2 KAP2-2 130 kinetoplast-associated protein 2-2 MLRRTVSNFAMSPYMLFISDLAKTGKLKGIRTPGKFVGKKYRQLSAKEKAALQQRAKQASTPAMTAYRRMAHREMSNKSVPIEQRRANLTKKWNETKQAQRAKAQKAQKKPKSAKSKVKKAAKKAKKSKK